Home Favorites My Account Menu
login
Advertisement

Search for a Worksheet

filter by
Grade
 
Spelling Favorite Created By Created on Words List 22
6th Grade Bible
Wednesday
Feb 21, 2024
accidentally comparatively entangleevacueeextinguish extraneousfragileirrevocablemarriagemileageperceive persevereprejudice university vertebra
Load
Unit 3 Week 5
Ashley Price
Wednesday
Feb 21, 2024
interceptintercominteriminterruptintertwineoverjoyedoverloadoverratedoverreactoverweightsubheadingsubmarinesubmergesubwaysubzeroundercookedunderfedunderfootunderpassunderstudy
Load

Wednesday
Feb 21, 2024
camecatchcaughtcomefindfoundgavegivemademakesaidsaysleepslepttaketelltoldtookwearwore
Load
Spelling Sort 59
ROOTS Lesson 15
Joanne Wilbers
Wednesday
Feb 21, 2024
locallocationlocomotionrelocatetechnicalitytechniciantechniquetechnology
Load

Wednesday
Feb 21, 2024
askedbumpeddressedjumpedloadedmailedmeltedmissedneededpassedpickedprayedrainedsnowedstartedturnedtwistedwaitedwalkedyelled
Load
Spelling sort 58

Wednesday
Feb 21, 2024
badgesboxesbushesclassesdishesdresseseyesgirlsglasseshousesincheslunchesmonthspagespiecesplacesplantsstitchestaxeswishes
Load
Spelling Sort 57

Wednesday
Feb 21, 2024
aren'tcould'vecouldn'tdoesn'thasn'there'smight'veshe'llshould'veshouldn'tthere'sthey'llweren'twhat'swhere'swho'llwho'swould'vewouldn'tyou'll
Load
Spelling Sort 56
4 grade List 23
Monica Herrera
Wednesday
Feb 21, 2024
North CarolinaOhioTrinityachieveadviceaisleartificial atheistcastlecheerfulness clothing compromisedata delightfulevaluate flexiblefurniture honest intelligenceinterfere khakimusclepersuadeperturbpolicepreceptionscissorssoldierukulele virtue
Load
4 grade List 23
Monica Herrera
Wednesday
Feb 21, 2024
North CarolinaOhioTrinityachieveadviceaisleartificial atheistcastlecheerfulness clothing compromisedata delightfulevaluate flexiblefurniture honest intelligenceinterfere khakimusclepersuadeperturbpolicepreceptionscissorssoldierukulele virtue
Load

Wednesday
Feb 21, 2024
aboutaboveacrossafraidagainagoaheadalivearoundawaybecausebecomebeforebeginbehindbelievebelongbelowbesidebetween
Load
Spelling Sort 55

Wednesday
Feb 21, 2024
atebrakebreakeighthairharemailmalemeatmeetpairpearsailsaleslaysleighstealsteelsweatsweet
Load
Spelling sort 54

Wednesday
Feb 21, 2024
boardboredchordcoarsecordcourseforforthfourfourthhoarsehorseoarorepoorporesoarsorewarnworn
Load
Spelling sort 53
Module 6 Week 2 Play Louis Play - Vocabualry
Jacque Korth
Wednesday
Feb 21, 2024
authenticbarscontagiousdiscriminatoryduetsexposurefeversolosstereotypicalwillful
Load
Unit 5 Week 5
Wednesday
Feb 21, 2024
anchoranklebarberbucklecheddarcradlecuddledoublefiddlefrecklegamblehumblehustlejunglemarbleneedlepebbleramblesinglestaplestifletackletangletroubleuncle
Load
Week 25 Words
CCID
Wednesday
Feb 21, 2024
ankleappearsarrangebracebraceletbreathbreathecalmcircusconsentedcontinuecontinuedimprisonperhapsstatestatementtheirtheywritwritten
Load

Wednesday
Feb 21, 2024
attendancecompletionconcentrationconventiondevelopmentdisagreementexistenceimprovementinformationintermissioninventionirrigateperfectlypreparationrefreshmentrespectfulreversibleunbelievableuneventfulunhappiness
Load
Unit 27

Meagan Welch
Wednesday
Feb 21, 2024
Januaryauthorcalanderdeskdrilleleven expirenovelofferoriginalpicturerubyscripttimelineturn
Load

Meagan Welch
Wednesday
Feb 21, 2024
accessoryacquiesceasthmaaversebarracudaexpendituregenerousincandescentobjectivepermittedpreliminaryprounouncerapportsemicirclesimultaneously
Load

Mattiemay Brown
Wednesday
Feb 21, 2024
alabamaarkansasdelawarefloridakentuckylouisianamarylandmississippinorth carolinaoklahomasouth carolinatennesseetexasvirginawashington dcwest virginia
Load
2.2 spelling test
Cydnei Bogard
Wednesday
Feb 21, 2024
apprentinceaveragecabbagecooperativecouragecreativedetectiveheritageimagejusticeknowledgemeasurenativeolivepassageprejudicerelativeservicestoragevoyage
Load

Wednesday
Feb 21, 2024
anotherdoesevenhandlandlarge mentryturn uswhy
Load
sped ela 634855-1037889-cg6x
ashlynn
Wednesday
Feb 21, 2024
antisocialanxietydanny fenton classic galactosemiadanny fenton classic phenylketonuriadanny fenton galactosemiadanny fenton hypoglycemiadanny fenton phenylketonuriadanny fenton-phantomdanny phantomdanny phantom a glitch in timedanny phantom clonedanny phantom final episode- phantom planetdanny phantom heroes and villainsdanny phantom the next generationdanny phantom- sam. and danny's futer adventure's goin' ghostdepressionemo ultra-recylo vegeterianemogoth ultra-recylo vegeterianemogothic ultra-recylo vegeteriangothic ultra-recylo vegeterianhigh protein dietlearning disabilitieslow protein dietmeat eaterptsdsam manson vegansam manson vegeteriansamantha manson classic galactosemiasamantha manson galactosemiascoliosisself proclaimed emogothic ultra-recylo vegeterianself proclaimed ultra-recylo vegeterian emogoth ghost hunting sidekickshytv seriestv showultra-recylo vegeterianultra-recylo vegeterian self proclaimed gothvegeterian
Load
sped 5th grade ela. cocosheets.com/1037889-cg6x
c-21
Wednesday
Feb 21, 2024
authorcaterpillarcleverdollarhaven'thorrorhumorinventormayornectarrefrigerator sailorsingerswimmer teacherthey'revinegarvisitorworkerwould've
Load

Hannah Brown
Wednesday
Feb 21, 2024
bulgecollapsecollidecombinecompetecompletecontaincontrastcontrolconvincecould'veinsultpulseresultshould've
Load
week 21
3rd grade List 23
Monica Herrera
Wednesday
Feb 21, 2024
Calvarycafeteriacalculatorcalendarcapitalcelebratecelerycoconutconfidencecontinuallycottoncupboarddecisiondistanceglanceicicleinfluencejusticenoticeparticipatepracticepresenceprincerecessscenery
Load
Lesson 16
Cynthia Johnston
Wednesday
Feb 21, 2024
answeredbeginningbotheringcancelledcarpetingchattingcompellingdepositedgatheringknittinglisteningoccurredorderedquizzedscannedscrubbedshruggedskimmedstunnedsufferingthreateningtotaledupsettingwanderedwhipped
Load

Wednesday
Feb 21, 2024
HabakkukHaggaiZephaniahartilleryastronautbarrackscolonelconquerorcorpshelicopterinspectionlieutenantmissilenavigationopponentpersonnelpromotionradarsatellitesergeantsoldierspecialistsubmarineuniformvolunteer
Load
Week of 3/4 - 3/8
Jillian Morrissey
Wednesday
Feb 21, 2024
bleachersemployeeeuphoriaincreasejourneymildewneighborpedigreeproteinreceivesqueamishsweatertreatmentweatherweightless
Load
Week of 3/4 - 3/8
1-21 PCI
Wednesday
Feb 21, 2024
asbigbycitydofarmhomeinislakelike livemynotoceanonseesmallthethistownwhereyou
Load
James Forten Lesson 14
Cynthia Johnston
Wednesday
Feb 21, 2024
actualannualappreciateareaaudiocasualcreatecrueldiagnosedialdietgenuineinfluencemediamuseumpatriotpioneerpriorrealizeriotruinsocietytheatertrialvisualize
Load
Spelling Quiz Week 23
Wednesday
Feb 21, 2024
achieveagreeapronauthorbracketbucketbushelchickenclothingdeclaredegreegathermachineposterratherrocketsecretticketwhetherwhiskers
Load
Spelling Quiz Week 23 SPED **
Week 23 Spelling Quiz
Wednesday
Feb 21, 2024
agreeauthorbucketbusheldeclareposterrocketsecretticketwhether
Load
Spelling Quiz Week 23*
Week 26
Wednesday
Feb 21, 2024
captioncentercoolercrunchgrudgehopefulnationrotatesketchstation
Load
Contractions (Harry Houdini Box) 4
Connie Mouser
Wednesday
Feb 21, 2024
I'vearen'tcouldn'tdoesn'tdon'thadn'thaven'there'sit'sshouldn'tthere'sthey'rewasn'twe'rewe'vewhen'swhere'swon'twouldn'tyou're
Load
Skills 6 Lesson 16.1 half list
Wednesday
Feb 21, 2024
Washingtonbattlecannondeathhawksmarchnavypaintingsupporttroops
Load

Wednesday
Feb 21, 2024
arrivalheritageimmigrantsinterviwepermission
Load
vocabulary 2-21
Ls. 7 Silent Letters (bt-ck-gu-mn-sc)
Connie Mouser
Wednesday
Feb 21, 2024
ascentautumncolumndebtdoubtguardianintrigueleaguenickelpocketrocketscenicsciencesolemnsubtle
Load

Wednesday
Feb 21, 2024
argumentclaimevidencegenerationmarinemutualotherwisepurposereasonsupporttopicvisual
Load
E-22
Julie Bender
Wednesday
Feb 21, 2024
accumulationanniversaryanticipationappreciationcafeteriaclassificationcongratulationscuriositydangerousdiagonallydiscriminationelectricityelementaryenthusiasticgenerosityimaginationmagazinemisunderstandingorganizationparagraphparticularlyundeiableunderestimateunforgettableuniversity
Load
skills 6 lesson 16.1
Wednesday
Feb 21, 2024
BritishCongressDolleyIronsidesMadisonWashingtonbattlecannondeathhawksimpressmentmarchmerchantsmonarchynavypaintingpavedpresidentsupporttroops
Load

Brittanie Tunoa
Wednesday
Feb 21, 2024
bloomboostcookbookcrewcrookflewgrewreviewroomrootscoopshookspoonstewstoodthrewyou
Load

Kelli Davis
Wednesday
Feb 21, 2024
authorbecauseboughtbroughtcoulddaughterenoughfaucetfoughtsausageshouldtaughtthoughtouchwould
Load
Spelling Week 24
Kyle Dingman
Wednesday
Feb 21, 2024
aren't beforecarechartfarmhardhorselargemoremorningnorthpartnerstarestartwarning
Load
Week 24
Homographs
Lisa Beabout
Wednesday
Feb 21, 2024
amongconstructconsultcontentdigestentrancesequationfinanceinclineinvalidmanifestminuteresearchtransplantupset
Load
homographs
Spelling Words
Wednesday
Feb 21, 2024
atbutfourintonewourridesawthatwithyes
Load
Unit 16 (Blocks I & III)
Sheena Fisher
Wednesday
Feb 21, 2024
adorableaffordableavailablebelievablebreakablecapablechewabledependabledisposabledurablefashionablelovablemiserableportablepredictableprofitablereliablereusablevaluablewashable
Load
Unit 7 Review (Ls. 25-28) 7
Connie Mouser
Wednesday
Feb 21, 2024
equinoxesfiefsleavesliveslogosmismatchesmottospatiosplaintiffsportfoliosquartersreflexesreproachesserfsshampoossterostaboostorpedoestorsosvetoes
Load
Week 25
Elvia Avila
Wednesday
Feb 21, 2024
authorawfulboughtdistraughtfaultfoughtnaughtysoughtsprawlssquawk
Load

Wednesday
Feb 21, 2024
EndeavorGlamorousGymnasiumHeadquartersInconvernienceInnumerable InsufficientInternallyInterrogateLegitimateLeisure
Load
5th IOWA Vocab. #4
Dominique Cooper
Wednesday
Feb 21, 2024
ceasecoarsedevourexceedfinickygullylandslideprecisesphericaltally
Load
Unit 13
Kerrie Hayes
Wednesday
Feb 21, 2024
bigdidhastogetheryes
Load
Spelling Test (Modded)
Georgia Evans
Wednesday
Feb 21, 2024
AlmostAthleteBelieveCentipedeChariotChiefChimneyDegreeElectrictyEnemyExperienceFancyGreaseIncreaseMoneyReallyScenicSecretStadiumSucceedTedious
Load
Spelling Test
Spelling Words #17
Wednesday
Feb 21, 2024
airbarebearbeardblearycarecarelesschairfearhairnearpairpearshareshearingstairwaytearwear
Load

Wednesday
Feb 21, 2024
destroyenoughfashionforgetfulnoisephotographyphraseroofroughtough
Load

Wednesday
Feb 21, 2024
acheattackbankerblanketearthquakeelectricequaljunkmistakemonkeypicnicpocketpublicriskystomachstrucktopictrack
Load

Shannon G Wagoner
Wednesday
Feb 21, 2024
appleballsbeansbearsdancehoodpeaprinceprincessstalkwolf
Load

Shannon G Wagoner
Wednesday
Feb 21, 2024
appleballsbeansbearsdancehoodpeaprinceprincessstalkwolf
Load

Mrs. Wag
Wednesday
Feb 21, 2024
appleballsbeansbearsdancehoodpeaprinceprincessstalkwolf
Load

Wednesday
Feb 21, 2024
Ave.Dr.Mr.Mrs.Ms.Rd.St.anyonebirthdaygrandmother
Load
CKLA U11, L6-11
Wednesday
Feb 21, 2024
accountannouncementauthorboundchoicecowfountainjointloyaltynoisesquawked taughtturquoisevoice
Load
Week 24 Spelling Worksheets r controlled er
Wednesday
Feb 21, 2024
commercecomplyconcernconservedeprivedeservedessertediblefertileinterchangekernelleveragemodernnervousobserveperfectpersonpreserveprosperousreserveseversparseterminateverbalverdict
Load
Vocabulary Review 8th grade
Wednesday
Feb 21, 2024
Along withAlthoughBrieflyBulldozerCamouflageFurthermoreIn spite ofIndeedIndigenousLikewiseMainlandMattressMeagreMoreoverOn the other handSimultaneousStriveUninterestedWhereasWorship
Load
Week 23 Worksheets
Wednesday
Feb 21, 2024
burdencurfewcurrentcursivecursordelicatefiguredfuriousfuryjourneyjurorleisuremurmuroptimisticpluralpurchasepurposepursuitquirkyruralsurplussurroundsympathetictemporaryurban
Load
Feb 20th, 2024
Wednesday
Feb 21, 2024
amicableominousoutrageousparachuteparalysisrehearsalroommateschismshudderingtryannyutopia
Load
feb 20th spelling list
Unit 3, Week 4
Trina Greco
Wednesday
Feb 21, 2024
armiesarrowsbabiesberriescavesclamscouchesdressesflowersfriendsglasseshobbiesholidaysmintsmistakesmossesparentspropsranchestigers
Load
Unit 3, Week 4
Level 35 sonday 1
Wednesday
Feb 21, 2024
chewdrawgrowlaceload minenearnewnicepitchriceridgeslidespeakstewteachteamwagewhatwho
Load

Wednesday
Feb 21, 2024
atomchargeelectronnegativeneutronnucleusorbitpositiveprotonsubatomiczero
Load
Week 21 EC 5D
Jenny Guyton
Wednesday
Feb 21, 2024
equallyhelplesslypitchroughershamewidely
Load

CLineback
Wednesday
Feb 21, 2024
achievebeigebelievebriefceilingcriedeightyfieldfierceneighborniecepiecereceiptreceivereliefrepliesretrievesleighveinweight
Load
List 22

Wednesday
Feb 21, 2024
AccomplishAnnoyAtmosphereAwaitedBudgetCharacterDesignDifferentDigestFascinateGymnasiumJewelKindnessKowledgeQuicklyRecentlyRefrigerateSubjectThoughtYesterday
Load
Chapter 6 Voc. Math
Paige Vick
Wednesday
Feb 21, 2024
a. perpendicular bisectorb. concurrent linesc. point of concurrencyd. circumcentere. incenterf. mediang. centroidh. altitude of a trianglei. orthocenter
Load

Wednesday
Feb 21, 2024
MontanaNebraskaachievementannouncearrivalcancelcertificatecitizencyberspacedamagingdescribedemphasizedexpensivefavoritemeasureperseverancerepetitionsentencesequencesuitable
Load
List #19
Vocabulary
Wednesday
Feb 21, 2024
DebateParlimentProposalResolveUnion
Load
Vocabulary

Wednesday
Feb 21, 2024
antisocialartificialbeneficialcrucialfacialofficialracialsocialspecialsuperficial
Load
ies
Wednesday
Feb 21, 2024
LibrariesPhotocopiesSecretariesactivitiesberriescenturiesdiariesditionariesinjuriesmomories
Load
Homework 2/21-2/23
Amber Scott
Wednesday
Feb 21, 2024
affordarenabaggageburrowchambercolumnjaggedshallowtourventure
Load

Tuesday
Feb 20, 2024
breezecastingcloudsdriftedeartheasyelongatedemergedfocusgazedgentlygroundrevisionshadowssilencesunlitsunshineswayedunblinkingwarm
Load

Tuesday
Feb 20, 2024
AdventureCastleElevatorEscalatorIncredibleLandscapePassengersReservationSandstormScarvesSkyscraperTransportsUncomfortableconsist ofextreme
Load
List 22 - Word Family and ING
K. Buchanan
Tuesday
Feb 20, 2024
ArizonaWashington, DCanythingblinkingbringclockdancingdiagramflingindexlaughinglengthminutepaintingphotosynthesissingingstringtalking
Load
Suffixes ing and word families

Shaileni Narayan
Tuesday
Feb 20, 2024
audienceaudioauditauditionauditoriumauditorybankruptdisruptiondisruptiveinscriptioninspectionprospectretrospectiverupturescribblescriptspectaclespectatorspeculatetranscribe
Load

Robyn Schaetzel
Tuesday
Feb 20, 2024
audienceaudioauditauditionauditoriumauditorybankruptdisruptiondisruptiveinscriptioninspectionprospectretrospectiverupturescribblescriptspectaclespectatorspeculatetranscribe
Load
U5 W5 EJohnson Goes West
Unite 5, Weeks 3 & 4
Juan Saavedra
Tuesday
Feb 20, 2024
KneelKnitKnockKnotKnuckleWrapWringWristWriteWrong
Load
Week 19
Karie Feng
Tuesday
Feb 20, 2024
againchallengingchangeclimbcurioushouselightoffpagepictureplaypointspellthoughttogether
Load
Week 19

Janine Magaso
Tuesday
Feb 20, 2024
at oncebulkcarefulcostcountdollareateveryideaneverpennysnacksoundspend
Load
BJU 19
Tuesday
Feb 20, 2024
announcementcarpentercedarcentercollarconsiderfavorgodlinessgrammarhonestylunarmannermayormeasurementministermolarsmonitorpolarrememberedsurrenderwireless
Load

Tuesday
Feb 20, 2024
agecentschangesdicegiantgymsmessagemiceofficepagesplacedpouncepricespacewage
Load
2/19/24 Tier 3 Spelling
Alison Bourassa
Tuesday
Feb 20, 2024
AlternativeAmusementAnalysisAnalyzeAncestorAnniversaryAppreciateArtificialAssistanceAssociation
Load

Tuesday
Feb 20, 2024
AchieveAuthorBracketBushelClothingCurtainDeclareDegreeDisturbFormalMachinePosterSecretWhetherWhiskers
Load

Allan Gao
Tuesday
Feb 20, 2024
caissncalatheacalquecannellinicapriciouscarbohydratecarbononiferouscarcajou
Load
It is a spelling bee tester. very helpful
2/19/24 Tier 2B Spelling
Alison Bourassa
Tuesday
Feb 20, 2024
BridalDentalGerbilProposalPupilQuizSimile
Load
2/19/24 Tier 2A Spelling
Alison Bourassa
Tuesday
Feb 20, 2024
DentalHemisphereMetaphorNasalPassagePioneerProposalProverbQuizToday
Load
Chapter 20 Spelling List
Judy King
Tuesday
Feb 20, 2024
afternoonanywherebusinessbytecannotdatadesktopdownstairselectriceveryoneeverythingfunctionfunctionitselflandmarkmodernoneselfproofreadroadblocksomebodysuitcasethroughoutundergroundwatercolors
Load
Chapter 20 Spelling List
CKLA Unit 7 Lessons 6 - 10 Spelling List
Joe Tremblay
Tuesday
Feb 20, 2024
declarationgrievanceincidentindependencemilitiamonarchyrepresentativesurrendervaliantvictory
Load
CKLA Unit 7 Lesson 6 - 10 Spelling List
Spelling
Sittie al-shaifa Ansarola
Tuesday
Feb 20, 2024
AppearanceNeophyteOpportunePhantomProsperousReferendumScorchingWarrenWearyWell-bredWhistlingWittyWivinaX chromosomeXhosaXylophoneYahweh's Divine ProvidenceYankeeYorkshireYugoslaviawell-knownyacht
Load
Reading Spelling
CKLA Unit 7 Lessons 1 - 3 Vocabulary
Joe Tremblay
Tuesday
Feb 20, 2024
accurateburdeneliminateexportgrievancesimportimposedportableportfolioreportsupporttransport
Load
CKLA Unit 7 Lessons 1 - 3
Wonders Unit 4 Week 3
Chelsea Pettis
Tuesday
Feb 20, 2024
combatcompactconductconflictcontentcontestcontractdesertentranceexcuseextractinsertminutepermitspresentprotestrebelrefuseresearchsubject
Load
Wonders Unit 4 Week 3
Week 11 Spelling/Vocabulary
Kathleen Rubick
Tuesday
Feb 20, 2024
airportclassmatedrivewayflashlightgoodbyehaircuthomesickmailboxpredictragerapidlysource
Load
Week 11
Test
Tuesday
Feb 20, 2024
apprenticeconventionaldemocracyexpertextraordinaryharmonymundanerivalrystunningtyranny
Load
Grow Your Vocabulary Chapter 15
Tuesday
Feb 20, 2024
confinedefinedeterminationdetermineexterminatefinfiniteindefiniteinfinitypredeterminererefinetermtermterminal
Load
American Revolution - Vocabulary List 6
Tuesday
Feb 20, 2024
confrontationexportgovernmentgovernorimportleviedlevy
Load
American Revolution - Vocab List 6
Advertisement